PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_40226
Common NameKK1_039134
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family MYB
Protein Properties Length: 352aa    MW: 40361.2 Da    PI: 9.845
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_40226genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding48.52.1e-15655148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHT..TTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmg..kgRtlkqcksrwqkyl 48
                     r+rW  eEd ll  +v+q+G++ W++++++m+  ++R +k+c +rw +yl
    C.cajan_40226  6 RQRWKSEEDALLCAYVRQYGPREWNLVSQRMNtpLNRDAKSCLERWKNYL 55
                     89**********************************************97 PP

2Myb_DNA-binding35.81.8e-1162105247
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      g  T+eE+ l +++ +++G++ Wk+Ia++++ gRt+k +  +w  +
    C.cajan_40226  62 GCLTEEEQRLVIRLQAKHGNK-WKKIAAEVP-GRTAKRLGKWWEVF 105
                      677******************.*********.*****999999766 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.284155IPR017930Myb domain
SMARTSM007172.6E-12557IPR001005SANT/Myb domain
PfamPF002499.3E-13655IPR001005SANT/Myb domain
SuperFamilySSF466897.34E-216100IPR009057Homeodomain-like
CDDcd001671.03E-6855No hitNo description
Gene3DG3DSA:1.10.10.603.3E-19862IPR009057Homeodomain-like
PROSITE profilePS5129423.19556110IPR017930Myb domain
SMARTSM007171.4E-960108IPR001005SANT/Myb domain
PfamPF002496.5E-1061102IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.7E-1463104IPR009057Homeodomain-like
CDDcd001671.72E-665106No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 352 aa     Download sequence    Send to blast
MEMKERQRWK SEEDALLCAY VRQYGPREWN LVSQRMNTPL NRDAKSCLER WKNYLKPGIK  60
KGCLTEEEQR LVIRLQAKHG NKWKKIAAEV PGRTAKRLGK WWEVFKEKQQ REKQEIHKAI  120
GPVDDTKYDH ILETFAKKLV KEQHPSQSPY LMVAASNGPA SASASASSAL FPPWLSNSSS  180
TNPSSAIRPP SPSVTLSLSS STAWLQPERR LGNAATPHGG SVSAFGDNMM VSELIECCKE  240
LEEGYRAWVV HRKEAAWRLR RVELQLEAEK ASRRKEKMDE IEAKIKALWV EQNAVLDRIE  300
SECREQLAGM RRDAENKEQK LAEQWNAKHM RVVKCMEQVG CRMPQIAEPN GR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A9e-16994789MYB PROTO-ONCOGENE PROTEIN
1mse_C9e-16994789C-Myb DNA-Binding Domain
1msf_C9e-16994789C-Myb DNA-Binding Domain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150421e-168AP015042.1 Vigna angularis var. angularis DNA, chromosome 9, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007133992.10.0hypothetical protein PHAVU_010G009900g
SwissprotO809311e-142AS1_ARATH; Transcription factor AS1
TrEMBLA0A151RAZ30.0A0A151RAZ3_CAJCA; Transcription factor AS1
STRINGVIT_08s0007g00410.t011e-168(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF25973369
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37630.11e-130MYB family protein